PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G08690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 943aa    MW: 103068 Da    PI: 6.0411
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G08690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28596647152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  OMERI01G08690.1 596 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 647
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541586667IPR003035RWP-RK domain
PfamPF020426.6E-26599647IPR003035RWP-RK domain
SuperFamilySSF542778.5E-22839935No hitNo description
SMARTSM006667.6E-25849931IPR000270PB1 domain
PfamPF005641.2E-15849930IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.3E-25849930No hitNo description
PROSITE profilePS5174519.198849931IPR000270PB1 domain
CDDcd064071.38E-33850930No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MEVDPSSSSP GAGEGGVGGG GGDLWPFDSL TTSLLFSSVS ASPQPLPASS SSWLTPPSPL  60
WLFDERQLLP LDMGTPAAPP TAPPAEAAAV AAAVVEEVHR TRSGNSDTTS KRVDQINSKW  120
QFHLSIDDNT DSSCLFKERL TQALRYFKES TDQHLLVQVW APVKSGDRYV LTTSGQPFVL  180
DQQSIGLLQY RAVSMMYMFS VDGENAGELG LPGRVYKQKV PEWTPNVQYY SSTEYPRLNH  240
AISYNVHGTV ALPVFDPSVQ NCIAVVELIM TSKKINYAGE VDKVCKALEA VNLKSTEILD  300
HPNVQICNEG RQSALVEILE ILTVVCEEHK LPLAQTWVPC KYRSVLAHGG GVKKSCLSFD  360
GSCMGEVCMS TSDVAFHVID AHMWGFRDAC VEHHLQKGQG VSGKAFIYRR PCFSKDISQF  420
CKLEYPLVHY ARMFGLAGCF AICLQSMYTG DDDYILEFFL PPNCRNEYDQ NALLESILAR  480
MKKCLRTLKV VGNGDTNEVC LQISNVLIIE TEDLKTNVHF ENSEGCFRES PESNGSQRAH  540
EVDNGDNKVS VMSERHLLAD DNSQNNGASV GRPNGSGASD SLHKSNKPPE RRRGKAEKTI  600
SLDVLQQYFS GSLKNAAKSL GVCPTTMKRI CRQHGISRWP SRKINKVNRS LSKLKQVIES  660
VQGSDAAFNL TSITGPLPIP VGPSSDSQNL EKASPNKVAE LSNLAVEGDR DSSLQKPIEN  720
DGNLAILMSQ QGFIDANNNL QLEADKASHS RSSSGEGSIN SRTSEASCQG SPANQTFVCK  780
PIASTFAEPQ LIPEAFTKEP FQEPALPLSR MLIEDSGSSK DLKNLFISAV DQPFLARSSN  840
LVLMQNSGTV TIKASFKEDI VRFRFPCSGS VTALKDEVAK RLRIDVGMFD IKYLDDDHEW  900
VKLACNADLE ECMEISRHSG SHVIRLLVSD VSAHLGSSCG SSG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0BZP10.0A0A0E0BZP1_9ORYZ; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7